PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009626750.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB
Protein Properties Length: 271aa    MW: 31554.3 Da    PI: 5.6945
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009626750.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding45.71.5e-142067148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+W++eEd++l+ ++ ++G  +W+  ++  g+ Rt+k+c++rw +yl
   XP_009626750.1 20 KGAWSPEEDQKLKTYIMRYGIWNWSHMPKFAGLSRTGKSCRLRWVNYL 67
                     79******************99************************97 PP

2Myb_DNA-binding34.54.9e-1173118148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++  eE e+ v+  ++lG++ W++Ia++++ gR ++++k++++++l
   XP_009626750.1  73 RGPFIMEEVEIVVKTYQELGNR-WSAIAARLP-GRIDNEVKNFFHTHL 118
                      5677779***************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129420.2851571IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.3E-211569IPR009057Homeodomain-like
SuperFamilySSF466891.33E-2618114IPR009057Homeodomain-like
SMARTSM007174.4E-121969IPR001005SANT/Myb domain
PfamPF002493.7E-132067IPR001005SANT/Myb domain
CDDcd001672.40E-92267No hitNo description
Gene3DG3DSA:1.10.10.601.2E-2070122IPR009057Homeodomain-like
PROSITE profilePS5129413.92672122IPR017930Myb domain
SMARTSM007175.7E-872120IPR001005SANT/Myb domain
PfamPF002493.0E-973118IPR001005SANT/Myb domain
CDDcd001676.73E-679118No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 271 aa     Download sequence    Send to blast
MPRLPPQQQQ KSTNMEEIKK GAWSPEEDQK LKTYIMRYGI WNWSHMPKFA GLSRTGKSCR  60
LRWVNYLSPD VKRGPFIMEE VEIVVKTYQE LGNRWSAIAA RLPGRIDNEV KNFFHTHLKK  120
HLGVLKSTTR ARSNKRVLKK TKGNERKNAD KRSPDPVSSS DSSSIITCEE NQMMDVTMSL  180
YQTDGDCYNV VDQPNIEMEI SPVILESNPD DGGTYNSNCQ QLHDQFEYSH EYISEYYSSF  240
DSIDQFDMSS FWFDELWDAE TSDFLRDVIT N
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-231712024126MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754421e-35HG975442.1 Solanum pennellii chromosome ch03, complete genome.
GenBankHG9755151e-35HG975515.1 Solanum lycopersicum chromosome ch03, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009626750.10.0PREDICTED: myb-related protein Myb4-like
TrEMBLK4BIR82e-88K4BIR8_SOLLC; Uncharacterized protein
STRINGSolyc03g093930.2.16e-88(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G23250.12e-45myb domain protein 15